Alkalihalophilus pseudofirmus: BpOF4_10895 Help Entry BpOF4_10895       CDS       T01165                                  Name (GenBank) hypothetical protein   KO K06371   developmental checkpoint coupling sporulation initiation to replication initiation Organism bpf  Alkalihalophilus pseudofirmus Brite KEGG Orthology (KO) [BR:bpf00001]  09190 Not Included in Pathway or Brite   09193 Unclassified: signaling and cellular processes    99978 Cell growth     BpOF4_10895 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Sda Motif Other DBs NCBI-ProteinID:  ADC50232 UniProt:  D3FUR2 LinkDB All DBs Position complement(611338..611493) Genome browser AA seq 51 aa AA seqDB search MHSLSDDVLIQSYYRAQEYGLDDDFLDLLFRELCKRNLQHLASQLSTHPQE NT seq 156 nt NT seq  +upstreamnt  +downstreamnt atgcattcattatcagacgacgttttgatacaaagttattaccgagcacaagaatacgga ttagacgatgatttcctggacttattatttcgagagctatgcaagcgtaaccttcaacat ctcgcatcgcaactttctacacacccacaagaataa

DBGET integrated database retrieval system