KEGG   Alkalihalophilus pseudofirmus: BpOF4_16075
Entry
BpOF4_16075       CDS       T01165                                 
Symbol
bioI
Name
(GenBank) cytochrome P450 for pimelic acid formation for biotin biosynthesis
  KO
K16593  pimeloyl-[acyl-carrier protein] synthase [EC:1.14.14.46]
Organism
bpf  Alkalihalophilus pseudofirmus
Pathway
bpf00780  Biotin metabolism
bpf01100  Metabolic pathways
bpf01240  Biosynthesis of cofactors
Module
bpf_M00573  Biotin biosynthesis, BioI pathway, long-chain-acyl-ACP => pimeloyl-ACP => biotin
Brite
KEGG Orthology (KO) [BR:bpf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BpOF4_16075 (bioI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bpf00199]
    BpOF4_16075 (bioI)
Enzymes [BR:bpf01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.46  pimeloyl-[acyl-carrier protein] synthase
     BpOF4_16075 (bioI)
Cytochrome P450 [BR:bpf00199]
 Cytochrome P450, bacteria type
  CYP107 family
   BpOF4_16075 (bioI)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: ADC51264
UniProt: D3G0V2
LinkDB
Position
1612862..1614070
AA seq 402 aa
MNTVSQTKAKQIRLKRDDLFKDPYGLYKRLRERGPIYKGSILKQPGWFVTGYKETAYILK
DSSFFTRIPLPEATEKYSHLKQIQSKMMLYMNKEDHRKLRLLVNKGFTPKQIAGFRPLIE
EVVDSLLDELIVKEEFDVVSEFAFPLTSLVIATILGVPEEDRDRFRAWAALLLQSIDFSR
SHKTLEASDQLAEELSEYFSSLIAQKRAEPGDDLISMLIKENDCTENELISTFILLVIAG
HETTVNLISNTIYTFLKHPEQWKMLNENPTLAGSAIEEVLRFESPTQLTARVAMKDTEVA
GKHITCGEQLYLMLGAANRDPDVFDEPDEFLITRKKVPHLSFGLGAHFCLGSTLARLEAQ
IALSRFSKRVHTYNQTKTEIKWRPLTGFRALEKLRITVQTSN
NT seq 1209 nt   +upstreamnt  +downstreamnt
atgaataccgttagccaaacgaaagcaaaacagattcgtcttaaaagagatgacttattt
aaagatccgtatggcttgtataaacgattacgcgagagaggtccgatttataaaggaagt
atactgaagcagcccggatggtttgtaacaggatacaaagaaacagcctacatcctaaaa
gattcatctttttttactcgcattcctttacctgaagcgacagaaaaatacagccaccta
aaacaaattcaaagcaagatgatgctttatatgaacaaggaagatcaccgcaagctgcgg
cttcttgtgaacaaagggttcacacccaagcaaatagcgggattcagacctttaatagaa
gaggtcgttgattctcttttagacgaacttattgtaaaagaagaatttgatgttgtatct
gaattcgcctttccgcttacgagcttggtcattgcgaccattttaggcgtgccggaagaa
gaccgagaccgatttagagcctgggcagctttattacttcaatcaatagatttttcacgt
tctcataaaacattagaagcaagtgatcaattggcagaagagctgagcgagtacttctcc
tcattaatcgcccaaaaaagagcggagccgggcgacgatcttattagtatgctgattaaa
gaaaatgattgtacggaaaatgaattaatctctacatttatattgcttgtcattgctggt
cacgaaacaacagtcaatttaattagcaacaccatttacacctttctaaagcaccctgaa
caatggaagatgttaaatgaaaaccctactttggctggctctgcaattgaagaagtacta
aggttcgaaagtccaacacagctaacggccagagtggcgatgaaggatacagaagtggca
ggcaaacacatcacatgcggagagcagctatatcttatgctcggggcagcgaaccgagat
cctgatgtatttgatgagcctgatgaattcctcattacaagaaaaaaggttccgcatctc
tcttttggattaggtgctcatttttgtctaggttccacacttgccaggttagaagcacag
attgccctctctcggtttagtaaacgtgttcacacgtacaaccaaacaaagactgaaatc
aagtggcggccgctgacaggatttcgggcccttgaaaaactaagaatcacagtacaaacg
tctaattag

DBGET integrated database retrieval system