Bathycoccus prasinos: Bathy01g03750 Help Entry Bathy01g03750     CDS       T03089                                  Name (RefSeq) hypothetical protein   KO K09481   protein transport protein SEC61 subunit beta Organism bpg  Bathycoccus prasinos Pathway bpg03060   Protein export bpg04141   Protein processing in endoplasmic reticulum bpg04145   Phagosome Brite KEGG Orthology (KO) [BR:bpg00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     Bathy01g03750    04141 Protein processing in endoplasmic reticulum     Bathy01g03750  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     Bathy01g03750  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bpg04131]     Bathy01g03750   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:bpg02044]     Bathy01g03750 Membrane trafficking [BR:bpg04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     Bathy01g03750 Secretion system [BR:bpg02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    Bathy01g03750 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Sec61_beta Motif Other DBs NCBI-GeneID:  19018110 NCBI-ProteinID:  XP_007515307 UniProt:  K8E972 LinkDB All DBs Position 1:join(698824..698848,699094..699302) Genome browser AA seq 77 aa AA seqDB search MSGRPSAGGLRKRPGTGSGSNIAAKGGAANSSILKFYTDDSPGLKITPVVVLVMSVCFIG FVTILHAMSKIYQYKMS NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgtccggccgaccatctgcaggaggtttacgcaaacgcccaggcactgggtctggctcc aacatcgccgccaaaggcggcgcggcgaacagttccatccttaagttttacacggacgat tctcccggtttgaaaatcaccccggtggttgttctggtcatgtccgtgtgcttcatagga ttcgtgaccatcttacacgcgatgtcgaagatttatcaatacaagatgagttaa

DBGET integrated database retrieval system