Bathycoccus prasinos: Bathy02g03510 Help Entry Bathy02g03510     CDS       T03089                                  Name (RefSeq) hypothetical protein   KO K03008   DNA-directed RNA polymerase II subunit RPB11 Organism bpg  Bathycoccus prasinos Pathway bpg03020   RNA polymerase bpg03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:bpg00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     Bathy02g03510   09124 Replication and repair    03420 Nucleotide excision repair     Bathy02g03510  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:bpg03021]     Bathy02g03510    03400 DNA repair and recombination proteins [BR:bpg03400]     Bathy02g03510 Transcription machinery [BR:bpg03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Core subunits      Bathy02g03510 DNA repair and recombination proteins [BR:bpg03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       Bathy02g03510 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_L_2 RNA_pol_L Motif Other DBs NCBI-GeneID:  19017464 NCBI-ProteinID:  XP_007514509 UniProt:  K8EAJ9 LinkDB All DBs Position 2:complement(659213..659569) Genome browser AA seq 118 aa AA seqDB search MNQPSRAEKFLMPPGSRKLSYTPDTKLANAGEFVLMREDHTLGNMLRMELHNDPNVVFAG YQHPHPTDHRILIKVHTNGETNPVRAMREANQRLTEQVESLKTQWESELESVRDSGAI NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atgaaccaaccatcgcgagcggaaaaatttctcatgcctccgggcagtcggaaactctcg tacaccccggacacgaaattagccaacgccggggaattcgtcttaatgagagaagatcac acgctcgggaacatgctcaggatggaactgcacaacgacccgaacgtggtcttcgcgggg taccagcacccacaccctacggatcaccggattttgattaaagtgcacacgaacggagag acgaacccggtgagggcgatgcgagaggccaatcagagattgacggaacaggtggagagt ttgaagacgcagtgggagagcgagttggaaagcgtgagagatagcggggcgatttga

DBGET integrated database retrieval system