Bathycoccus prasinos: Bathy12g00040 Help Entry Bathy12g00040     CDS       T03089                                  Name (RefSeq) hypothetical protein   KO K10419   dynein light chain roadblock-type Organism bpg  Bathycoccus prasinos Pathway bpg04814   Motor proteins Brite KEGG Orthology (KO) [BR:bpg00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     Bathy12g00040  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bpg04131]     Bathy12g00040   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:bpg03037]     Bathy12g00040    04812 Cytoskeleton proteins [BR:bpg04812]     Bathy12g00040 Membrane trafficking [BR:bpg04131]  Endosome - Golgi transport   Rab GTPases and associated proteins    Rab associated proteins     Bathy12g00040 Cilium and associated proteins [BR:bpg03037]  Motile cilia and associated proteins   Dynein arm    Bathy12g00040 Cytoskeleton proteins [BR:bpg04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      Bathy12g00040 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Robl_LC7 LAMTOR5 Motif Other DBs NCBI-GeneID:  19012654 NCBI-ProteinID:  XP_007509875 UniProt:  K8F2H2 LinkDB All DBs Position 12:4725..5048 Genome browser AA seq 107 aa AA seqDB search MFVDETFKRLFSHAGVIGCAIIDREAGRIVHARGSKCINKSDFIASVASLLTNTASFSLK NDEVDYDEDGRGINMSPRCIRLRFERNELVIAPGEEYALVVIQECKR NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgttcgtcgatgaaactttcaagcgtctgttttcgcacgcgggtgtgattggctgcgca ataatcgatcgcgaagctggtcgcatcgtccatgcgcgtggttcaaaatgtatcaacaaa agtgattttattgcaagcgtggcgtctttgttgaccaacaccgcctctttttctctcaaa aacgacgaagttgactacgacgaagatggtcgaggaatcaatatgtcaccaaggtgcata cgcctccgattcgagcgaaacgaattagtcattgcaccgggagaggaatatgccttagtc gtaatccaagagtgtaagagatga

DBGET integrated database retrieval system