KEGG   Paraburkholderia phymatum: Bphy_1727
Entry
Bphy_1727         CDS       T00704                                 
Name
(GenBank) tRNA pseudouridine synthase B
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
bph  Paraburkholderia phymatum
Brite
KEGG Orthology (KO) [BR:bph00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bph03016]
    Bphy_1727
Enzymes [BR:bph01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     Bphy_1727
Transfer RNA biogenesis [BR:bph03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    Bphy_1727
 Prokaryotic type
    Bphy_1727
SSDB
Motif
Pfam: TruB_N TruB_C_2 TruB-C_2 TruB_C
Other DBs
NCBI-ProteinID: ACC70909
UniProt: B2JKT2
LinkDB
Position
1:complement(1970128..1971057)
AA seq 309 aa
MTQNQRPKVPRRALDGVLLLDKPVGLSSNDALIRAKRLYLAKKAGHTGTLDPLASGLLPL
CFGEATKFSQDLLEADKTYEATMRLGIRTTTGDAEGEAIETRDVTCDQAAVEQRLVQFRG
DIVQVPPMYSALKRGGKPLYEYARAGQTVEREGRQVTIHALELIACDLPDVTFRVTCSKG
TYVRTLAEDIGEALGCGAHLVMLRRTGVGALTLANSVTLDALSDAAQSERDAWLQPVDAL
LSTFPSVQLDEEATRRFLHGQRLKLTDLAVDDGVLLAAARTRVYGSKGKLLGVAKAADGV
LAPERLIVS
NT seq 930 nt   +upstreamnt  +downstreamnt
atgactcagaaccaacgtcccaaggtgccgcgtcgcgcgctggatggtgtgttgctgctc
gacaagcctgtggggctgtcgagtaacgacgcgctgatccgcgcgaagcgcctgtatctt
gcgaagaaggcggggcacacgggcacgctcgatccgctcgcgtcggggctgttgccgctc
tgcttcggcgaagcaacgaagttttcgcaggatctgctggaagcggacaagacgtatgaa
gcgacgatgcggctcggcattcgcacgacgacgggcgatgccgaaggcgaggcgatcgaa
acgcgcgacgtgacatgcgatcaggctgccgtcgagcagaggctcgtgcagtttcgcggc
gacatcgttcaggtgccgccgatgtattcggcgctcaagcgcggcggcaagccgctgtac
gagtacgcgcgcgccgggcagacggtcgagcgcgaagggcgccaggtgacgattcacgcg
ctggaactcatcgcgtgtgatttgcctgatgtgacttttcgtgtgacgtgcagcaagggt
acgtatgttcgtacgctggccgaggatatcggcgaagcgctcggatgcggggcacatctg
gtgatgttgcggcgtactggcgtcggggcgttgacgctggcgaattcggtgacgctggac
gcgttgtccgatgcggcgcaaagcgagcgtgatgcgtggctgcagcctgtcgatgcgttg
ctgtcgacgtttccttccgttcaactggatgaggaagcgacccggcgatttttgcatggc
caacggttgaagttgaccgatcttgctgtcgacgacggtgttttgctggcggctgctcgt
acgcgcgtgtatggcagcaaagggaaactgcttggcgtcgcgaaagccgccgacggtgtg
ctggcgcccgagcgtctcatcgtgagctag

DBGET integrated database retrieval system