Paraburkholderia phymatum: Bphy_4598 Help Entry Bphy_4598         CDS       T00704                                  Name (GenBank) anti-sigma-28 factor, FlgM   KO K02398   negative regulator of flagellin synthesis FlgM Organism bph  Paraburkholderia phymatum Pathway bph02020   Two-component system bph02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:bph00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     Bphy_4598  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     Bphy_4598  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:bph02035]     Bphy_4598 Bacterial motility proteins [BR:bph02035]  Flagellar system   Flagellar assembly proteins    Others     Bphy_4598 SSDB OrthologParalogGFIT Motif Pfam:  FlgM Motif Other DBs NCBI-ProteinID:  ACC73708 UniProt:  B2JR17 LinkDB All DBs Position 2:1662516..1662818 Genome browser AA seq 100 aa AA seqDB search MKIESSNNSITIHRPGAVRATNDAEAQGAVGAVRKTDAPLSGSSTVSLSTLPTASDADID TAQVESIKAALRDGTYTVDSSKIADGMMSNARDLLQTVSR NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgaagatcgaatccagcaacaacagcattaccattcaccggccaggtgcggtacgcgcc accaacgacgccgaagcgcagggtgccgtcggcgcagtgcgaaaaacggacgcgcccctt tcgggcagctcgaccgtcagcctgtcgacgctgcccacggcgagcgacgcggacatcgat acggcgcaggtcgaatcgatcaaggccgcgctgcgcgacggcacctatacagtcgattcc agcaagatcgccgacggcatgatgagcaacgcacgcgacctgctgcaaacggtaagccgc tga

DBGET integrated database retrieval system