Brachyspira pilosicoli B2904: B2904_orf2457 Help Entry B2904_orf2457     CDS       T02225                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism bpj  Brachyspira pilosicoli B2904 Pathway bpj00020   Citrate cycle (TCA cycle) bpj00720   Other carbon fixation pathways bpj01100   Metabolic pathways bpj01110   Biosynthesis of secondary metabolites bpj01120   Microbial metabolism in diverse environments bpj01200   Carbon metabolism bpj01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:bpj00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     B2904_orf2457   09102 Energy metabolism    00720 Other carbon fixation pathways     B2904_orf2457 Enzymes [BR:bpj01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      B2904_orf2457 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4 Fer4_2 Fer4_10 Fer4_21 Fer4_6 Fer4_9 Fer4_16 Fer4_15 LdpA_Fe-S-bd Fer4_13 Fer4_8 Fer4_17 Fer4_22 Fer4_4 Fer4_3 Fer4_Nqo3 Motif Other DBs NCBI-ProteinID:  AFR71783 UniProt:  J9UXY6 LinkDB All DBs Position complement(2524211..2524447) Genome browser AA seq 78 aa AA seqDB search MAKGRVIIDSEQCKGCSNCVSVCPTKILYLDKENMNSWGYYPAAVTDMEKCIGCANCAMM CPDICIKVERLDEKKEGK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggctaaaggtcgtgttattattgatagtgaacaatgtaagggttgttctaattgtgta tctgtatgtcctaccaagatattgtatttagataaggaaaatatgaattcttgggggtat tatcctgcagcggttacagacatggagaaatgtataggctgtgctaactgtgccatgatg tgcccagatatatgtataaaagtagagagacttgatgagaagaaggagggtaaataa

DBGET integrated database retrieval system