Burkholderia pseudomallei NCTC 13179: BBK_1539 Help Entry BBK_1539          CDS       T02894                                  Name (GenBank) putative acyl carrier protein   KO K02078   acyl carrier protein Organism bpk  Burkholderia pseudomallei NCTC 13179 Pathway bpk00998   Biosynthesis of various antibiotics bpk01100   Metabolic pathways bpk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bpk00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BBK_1539    00074 Mycolic acid biosynthesis     BBK_1539   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BBK_1539 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  AGZ27501 LinkDB All DBs Position 1:complement(1812349..1812570) Genome browser AA seq 73 aa AA seqDB search MNAFYEGLAEIFEIDASEVTPALALGEHNWDSLAIVSTIALADDCFGVLLNGQALGNCKT VADIDALVAAQKG NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgaacgcattctacgaaggcctcgcggaaatcttcgagatcgacgcgagcgaagtcacg cccgcgctcgcgctcggcgagcacaactgggattcgcttgcgatcgtgtcgacgatcgcg ctcgccgacgactgcttcggcgtgctgctcaacggccaggcgctcggcaactgcaagacg gtcgccgatatcgacgcgctcgtcgcggcgcaaaagggctga

DBGET integrated database retrieval system