Burkholderia pseudomallei NCTC 13179: BBK_2514 Help Entry BBK_2514          CDS       T02894                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bpk  Burkholderia pseudomallei NCTC 13179 Pathway bpk00998   Biosynthesis of various antibiotics bpk01100   Metabolic pathways bpk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bpk00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BBK_2514 (acpP)    00074 Mycolic acid biosynthesis     BBK_2514 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BBK_2514 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF1896 DUF1493 Motif Other DBs NCBI-ProteinID:  AGZ27470 LinkDB All DBs Position 1:2870443..2870682 Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEAEIKNEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYARANVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaacatcgaacaacgcgtgaagaagatcgtcgccgaacaactgggcgtcgccgaa gccgaaatcaagaacgaagcgtcgttcgtgaacgacctcggcgcggactcgctcgacacg gtcgagctggtgatggcgctcgaagacgagttcggcatggaaatcccggatgaagaggcc gagaagatcacgaccgttcagcaagcgatcgactacgctcgcgcgaacgtcaaggcgtaa

DBGET integrated database retrieval system