Burkholderia pseudomallei NCTC 13179: BBK_5193 Help Entry BBK_5193          CDS       T02894                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism bpk  Burkholderia pseudomallei NCTC 13179 Brite KEGG Orthology (KO) [BR:bpk00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bpk03036]     BBK_5193    03400 DNA repair and recombination proteins [BR:bpk03400]     BBK_5193 Chromosome and associated proteins [BR:bpk03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     BBK_5193 DNA repair and recombination proteins [BR:bpk03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       BBK_5193 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Motif Other DBs NCBI-ProteinID:  AGZ30353 LinkDB All DBs Position 2:complement(2074526..2074825) Genome browser AA seq 99 aa AA seqDB search MSTYLELKAKADEILRQAEDARRSELETVLKEVRTRVAEYGLTPEQVFGARRGRRGQQVH ASPTVPKYRDPKTGATWSGRGREPGWIKGKKRERFLIQQ NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgagtacttatctcgaattgaaagccaaagccgatgagatcctgcgtcaggcagaagac gcgagacgctcggaactcgagacggtcttgaaggaagttcgcacgcgcgtcgcggaatac ggattgacgccggaacaggtattcggcgcgcgccgcgggcgacgcggccaacaggtgcat gccagtccgacggttcccaaataccgcgacccgaaaacgggggcgacctggagcggccgg gggcgcgaaccgggctggatcaagggcaagaaacgcgagcgcttcctgattcagcagtaa

DBGET integrated database retrieval system