Burkholderia pseudomallei 1106a: BURPS1106A_2850 Help Entry BURPS1106A_2850   CDS       T00480                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bpl  Burkholderia pseudomallei 1106a Pathway bpl00998   Biosynthesis of various antibiotics bpl01100   Metabolic pathways bpl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bpl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BURPS1106A_2850 (acpP)    00074 Mycolic acid biosynthesis     BURPS1106A_2850 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BURPS1106A_2850 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF1896 DUF1493 Motif Other DBs NCBI-ProteinID:  ABN90174 UniProt:  A3NXM6 LinkDB All DBs Position I:complement(2804752..2804991) Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEAEIKNEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYARANVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaacatcgaacaacgcgtgaagaagatcgtcgccgaacaactgggcgtcgccgaa gccgaaatcaagaacgaagcgtcgttcgtgaacgacctcggcgcggactcgctcgacacg gtcgagctggtgatggcgctcgaagacgagttcggcatggaaatcccggatgaagaggcc gagaagatcacgaccgttcagcaagcgatcgactacgctcgcgcgaacgtcaaggcgtaa

DBGET integrated database retrieval system