Burkholderia pseudomallei 1106a: BURPS1106A_3958 Help Entry BURPS1106A_3958   CDS       T00480                                  Name (GenBank) putative acyl carrier protein   KO K02078   acyl carrier protein Organism bpl  Burkholderia pseudomallei 1106a Pathway bpl00998   Biosynthesis of various antibiotics bpl01100   Metabolic pathways bpl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bpl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BURPS1106A_3958    00074 Mycolic acid biosynthesis     BURPS1106A_3958   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BURPS1106A_3958 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  ABN90841 UniProt:  A3P0Q7 LinkDB All DBs Position I:3864014..3864235 Genome browser AA seq 73 aa AA seqDB search MNAFYEGLAEIFEIDASEVTPALALGEHNWDSLAIVSTIALADDCFGVLLNGQALGNCKT VADIDALVAAQKG NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgaacgcattctacgaaggcctcgcggaaatcttcgagatcgacgcgagcgaagtcacg cccgcgctcgcgctcggcgagcacaactgggattcgcttgcgatcgtgtcgacgatcgcg ctcgccgacgactgcttcggcgtgctgctcaacggccaggcgctcggcaactgcaagacg gtcgccgatatcgacgcgctcgtcgcggcgcaaaagggctga

DBGET integrated database retrieval system