Burkholderia plantarii ATCC 43733: bpln_1g01420 Help Entry bpln_1g01420      CDS       T04139                                  Name (GenBank) Putative acyl carrier protein   KO K02078   acyl carrier protein Organism bpla  Burkholderia plantarii ATCC 43733 Pathway bpla00998   Biosynthesis of various antibiotics bpla01100   Metabolic pathways bpla01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bpla00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     bpln_1g01420    00074 Mycolic acid biosynthesis     bpln_1g01420   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     bpln_1g01420 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Phosphatase Herpes_U44 Motif Other DBs NCBI-ProteinID:  ALK28973 UniProt:  A0A0B6RR76 LinkDB All DBs Position 1:complement(177945..178166) Genome browser AA seq 73 aa AA seqDB search MNAFYEGLAEVFEIDAAEVSPALVLADHNWDSLAIVSTIALADDCFGVLLNGQALGNCQT VADIEALVAAQKG NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgaacgcattctacgaagggctcgcggaagtcttcgaaatcgacgccgccgaggtgtcg cccgcgctggtgctggccgatcacaactgggattcgctcgcgatcgtctcgaccatcgcg ctggccgacgattgcttcggcgtgctgctcaacggccaggcgctcggcaactgccagacg gtggccgacatcgaagcgctggtcgcggcgcagaagggctga

DBGET integrated database retrieval system