Burkholderia plantarii ATCC 43733: bpln_1g01850 Help Entry bpln_1g01850      CDS       T04139                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism bpla  Burkholderia plantarii ATCC 43733 Brite KEGG Orthology (KO) [BR:bpla00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bpla03036]     bpln_1g01850    03400 DNA repair and recombination proteins [BR:bpla03400]     bpln_1g01850 Chromosome and associated proteins [BR:bpla03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     bpln_1g01850 DNA repair and recombination proteins [BR:bpla03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       bpln_1g01850 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS DUF4878 Motif Other DBs NCBI-ProteinID:  ALK29016 UniProt:  A0A0B6RH95 LinkDB All DBs Position 1:226653..226946 Genome browser AA seq 97 aa AA seqDB search MSSYKDLLAQREKLEKQIEEAKAKEYADVLNDVKQKISDYGFSLAELGLSRAKAAKAGRA RAGVAAKYRDPESGATWSGRGKPPRWIAGKNRDQFTI NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgtcttcttacaaggaccttctcgcgcagcgagaaaagctggagaagcaaatcgaggaa gccaaggcgaaggaatatgccgatgtcctcaacgacgtcaaacagaagatctcggattac ggcttctcgctggccgaactcggtctgagccgcgccaaggcggccaaggctggccgggca cgtgccggtgtcgccgcgaagtatcgcgatccggaatcgggcgcaacctggtctggccgc ggcaaaccgccgcgctggatcgccggcaagaatcgcgatcaattcacgatctga

DBGET integrated database retrieval system