Burkholderia plantarii ATCC 43733: bpln_1g05540 Help Entry bpln_1g05540      CDS       T04139                                  Name (GenBank) DNA-binding protein Fis   KO K03557   Fis family transcriptional regulator, factor for inversion stimulation protein Organism bpla  Burkholderia plantarii ATCC 43733 Brite KEGG Orthology (KO) [BR:bpla00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:bpla03000]     bpln_1g05540    03036 Chromosome and associated proteins [BR:bpla03036]     bpln_1g05540    03400 DNA repair and recombination proteins [BR:bpla03400]     bpln_1g05540 Transcription factors [BR:bpla03000]  Prokaryotic type   Helix-turn-helix    Other families     bpln_1g05540 Chromosome and associated proteins [BR:bpla03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     bpln_1g05540 DNA repair and recombination proteins [BR:bpla03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Facilitator       bpln_1g05540 SSDB OrthologParalogGFIT Motif Pfam:  HTH_8 HTH_30 Fis_N HTH_17 Xre-like-HTH Phage_NinH NUMOD1 Motif Other DBs NCBI-ProteinID:  ALK29381 UniProt:  A0A0B6RID2 LinkDB All DBs Position 1:complement(637484..637717) Genome browser AA seq 77 aa AA seqDB search MSKHNIEQCVRDSLDGYFRDLDGSNPHDVYDMVMSCVEKPMLEVVLEQAGGNQSLAAEYL GINRNTLRKKLQQHGLL NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcaagcacaacatcgaacaatgtgtccgcgacagcctggacggttatttccgggat ctcgacggctccaatccgcacgacgtctacgacatggtgatgtcctgtgtcgagaagccg atgctcgaggtggtgctcgaacaggcgggcggcaaccagtcgctggccgccgagtacctg ggcatcaatcgcaatacgctgcgcaagaagctgcagcagcacggtctgctgtag

DBGET integrated database retrieval system