Burkholderia plantarii ATCC 43733: bpln_2g13690 Help Entry bpln_2g13690      CDS       T04139                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism bpla  Burkholderia plantarii ATCC 43733 Brite KEGG Orthology (KO) [BR:bpla00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bpla03036]     bpln_2g13690    03400 DNA repair and recombination proteins [BR:bpla03400]     bpln_2g13690 Chromosome and associated proteins [BR:bpla03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     bpln_2g13690 DNA repair and recombination proteins [BR:bpla03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       bpln_2g13690 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Caps_syn_GfcC_N Histone_HNS_N Motif Other DBs NCBI-ProteinID:  ALK33599 UniProt:  A0A0B6S4S1 LinkDB All DBs Position 2:1730751..1731041 Genome browser AA seq 96 aa AA seqDB search MSNYHELLAQLNELTRQASEARETELKAVIADIRRAIAEYGLTERDLFPPRLGRPRKEDQ KPKPRYRDPETGATWTGRGRVPGWIAGQDRERFLIS NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgtcgaattaccacgagctgctcgctcaactgaacgagttgacccgccaggccagcgag gcccgcgaaacggagctcaaggccgtgatcgccgacattcgtcgcgcgatcgccgagtac gggctgaccgaacgcgacctgttcccgccgcggcttggccgtccgcgcaaggaggaccag aagccgaagccccgctaccgcgacccggagacgggcgcgacgtggacgggccgcggtcgc gtgccgggctggatcgccggacaggatcgcgagcgcttcctgatctcctga

DBGET integrated database retrieval system