Burkholderia pseudomallei 1710b: BURPS1710b_0084 Help Entry BURPS1710b_0084   CDS       T00289                                  Symbol bprA Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism bpm  Burkholderia pseudomallei 1710b Brite KEGG Orthology (KO) [BR:bpm00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bpm03036]     BURPS1710b_0084 (bprA)    03400 DNA repair and recombination proteins [BR:bpm03400]     BURPS1710b_0084 (bprA) Chromosome and associated proteins [BR:bpm03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     BURPS1710b_0084 (bprA) DNA repair and recombination proteins [BR:bpm03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       BURPS1710b_0084 (bprA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS YL1_C ROS_MUCR Rootletin Motif Other DBs NCBI-ProteinID:  ABA50703 UniProt:  Q3JY52 LinkDB All DBs Position I:complement(86887..87183) Genome browser AA seq 98 aa AA seqDB search MSQYAKIKAQIVELQAQAEEVRRQEIAAVVAELQGKIAEYGLTAQDLGFAERARRGRPPK KGPLPAKYRDPKSGNTWSGRGKPPHWIVGKNRERFLIG NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgtctcaatacgcgaaaatcaaggcgcagatcgtggagctgcaagcccaggccgaagaa gtacgtcgtcaggaaatcgcggccgtggtcgccgagttgcaaggcaagatcgccgagtac gggctcacggcgcaggacttggggttcgccgagcgggcgcggcgcggccggccgccgaag aagggcccgctgcccgccaagtaccgcgatccgaaatccggcaacacgtggagcggccgc ggcaagcccccgcattggatcgtcggcaaaaaccgcgagcgctttttgatcggctga

DBGET integrated database retrieval system