Burkholderia pseudomallei 1710b: BURPS1710b_0097 Help Entry BURPS1710b_0097   CDS       T00289                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism bpm  Burkholderia pseudomallei 1710b Pathway bpm00998   Biosynthesis of various antibiotics bpm01100   Metabolic pathways bpm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bpm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BURPS1710b_0097    00074 Mycolic acid biosynthesis     BURPS1710b_0097   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BURPS1710b_0097 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  ABA50351 UniProt:  Q3JY39 LinkDB All DBs Position I:100029..100253 Genome browser AA seq 74 aa AA seqDB search MMNAFYEGLAEIFEIDASEVTPALALGEHNWDSLAIVSTIALADDCFGVLLNGQALGNCK TVADIDALVAAQKG NT seq 225 nt NT seq  +upstreamnt  +downstreamnt gtgatgaacgcattctacgaaggcctcgcggaaatcttcgagatcgacgcgagcgaagtc acgcccgcgctcgcgctcggcgagcacaactgggattcgcttgcgatcgtgtcgacgatc gcgctcgccgacgactgcttcggcgtgctgctcaacggccaggcgctcggcaactgcaag acggtcgccgatatcgacgcgctcgtcgcggcgcaaaagggctga

DBGET integrated database retrieval system