Burkholderia pseudomallei 1710b: BURPS1710b_2147 Help Entry BURPS1710b_2147   CDS       T00289                                  Name (GenBank) mbtH-like protein   KO K05375   MbtH protein Organism bpm  Burkholderia pseudomallei 1710b Pathway bpm00261   Monobactam biosynthesis bpm01100   Metabolic pathways bpm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bpm00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BURPS1710b_2147  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bpm01008]     BURPS1710b_2147 Polyketide biosynthesis proteins [BR:bpm01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BURPS1710b_2147 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ABA50273 UniProt:  Q3JSB1 Structure PDB LinkDB All DBs Position I:2351790..2352014 Genome browser AA seq 74 aa AA seqDB search MDDELYFVVRNNEGQYSVWMDGRSLPAGWETVGEPATKQQCLQRIEQLWTDMVPASVREH LNQHSGPGIDYAVR NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggacgacgaattgtacttcgtagtgcgaaataatgagggccagtattcggtctggatg gacgggcgaagccttcccgccggttgggaaacggtcggcgaaccggcgacgaagcaacag tgtctgcaacgcatcgagcaactctggacggacatggtgcctgccagcgtccgcgagcat ctcaatcaacattcgggcccgggaatcgactatgccgtacgatga

DBGET integrated database retrieval system