Brucella pinnipedialis B2/94: BPI_II494 Help Entry BPI_II494         CDS       T01589                                  Symbol ybgT Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism bpp  Brucella pinnipedialis B2/94 Pathway bpp00190   Oxidative phosphorylation bpp01100   Metabolic pathways bpp02020   Two-component system Module bpp_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:bpp00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     BPI_II494 (ybgT)  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     BPI_II494 (ybgT) Enzymes [BR:bpp01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      BPI_II494 (ybgT) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Hemotin Motif Other DBs NCBI-ProteinID:  AEK55937 LinkDB All DBs Position 2:478338..478532 Genome browser AA seq 64 aa AA seqDB search MRATTLTDWKGSKMWYFSWLLGLPLAAAFAVLNAMWYELMDDRARKRLAADPTAELALEG NKHH NT seq 195 nt NT seq  +upstreamnt  +downstreamnt atgagagcaaccacgcttactgattggaaaggaagcaagatgtggtatttttcctggctt ttgggcctgccgcttgcagccgcgttcgctgtgctgaatgcgatgtggtatgagctgatg gacgaccgggcgcgcaagcgccttgccgccgaccccacggcggaactggcccttgaaggc aacaagcaccactga

DBGET integrated database retrieval system