Burkholderia pseudomallei BPC006: BPC006_I2180 Help Entry BPC006_I2180      CDS       T02301                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism bpq  Burkholderia pseudomallei BPC006 Pathway bpq00190   Oxidative phosphorylation bpq01100   Metabolic pathways bpq02020   Two-component system Module bpq_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:bpq00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     BPC006_I2180  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     BPC006_I2180 Enzymes [BR:bpq01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      BPC006_I2180 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB B277 Motif Other DBs NCBI-ProteinID:  AFR16050 LinkDB All DBs Position I:2153661..2153822 Genome browser AA seq 53 aa AA seqDB search MWYFSWILGIGVALGFGIINAMWLEANGNVPTGAPGDAPDAGEPATAPEGRRS NT seq 162 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttctcatggattctcggcatcggcgtcgcgctcggcttcggcatcatcaat gcgatgtggctcgaagcgaacggcaatgtcccgacgggcgcccctggcgacgcgcctgac gcgggcgagcccgccaccgcgccggagggccgacgttcgtga

DBGET integrated database retrieval system