Burkholderia pseudomallei BPC006: BPC006_I2889 Help Entry BPC006_I2889      CDS       T02301                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bpq  Burkholderia pseudomallei BPC006 Pathway bpq00998   Biosynthesis of various antibiotics bpq01100   Metabolic pathways bpq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bpq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BPC006_I2889    00074 Mycolic acid biosynthesis     BPC006_I2889   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BPC006_I2889 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF1896 DUF1493 Motif Other DBs NCBI-ProteinID:  AFR16744 LinkDB All DBs Position I:complement(2833751..2833990) Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEAEIKNEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYARANVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaacatcgaacaacgcgtgaagaagatcgtcgccgaacaactgggcgtcgccgaa gccgaaatcaagaacgaagcgtcgttcgtgaacgacctcggcgcggactcgctcgacacg gtcgagctggtgatggcgctcgaagacgagttcggcatggaaatcccggatgaagaggcc gagaagatcacgaccgttcagcaagcgatcgactacgctcgcgcgaacgtcaaggcgtaa

DBGET integrated database retrieval system