Burkholderia pseudomallei BPC006: BPC006_I3999 Help Entry BPC006_I3999      CDS       T02301                                  Name (GenBank) putative acyl carrier protein   KO K02078   acyl carrier protein Organism bpq  Burkholderia pseudomallei BPC006 Pathway bpq00998   Biosynthesis of various antibiotics bpq01100   Metabolic pathways bpq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bpq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BPC006_I3999    00074 Mycolic acid biosynthesis     BPC006_I3999   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BPC006_I3999 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  AFR17822 LinkDB All DBs Position I:3877328..3877552 Genome browser AA seq 74 aa AA seqDB search MMNAFYEGLAEIFEIDASEVTPALALGEHNWDSLAIVSTIALADDCFGVLLNGQALGNCK TVADIDALVAAQKG NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgatgaacgcattctacgaaggcctcgcggaaatcttcgagatcgacgcgagcgaagtc acgcccgcgctcgcgctcggcgagcacaactgggattcgcttgcgatcgtgtcgacgatc gcgctcgccgacgactgcttcggcgtgctgctcaacggccaggcgctcggcaactgcaag acggtcgccgatatcgacgcgctcgtcgcggcgcaaaagggctga

DBGET integrated database retrieval system