Burkholderia pseudomallei MSHR346: GBP346_A2970 Help Entry GBP346_A2970      CDS       T00894                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bpr  Burkholderia pseudomallei MSHR346 Pathway bpr01100   Metabolic pathways bpr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bpr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GBP346_A2970 (acpP)    00074 Mycolic acid biosynthesis     GBP346_A2970 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GBP346_A2970 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF1896 DUF1493 Motif Other DBs NCBI-ProteinID:  ACQ96510 LinkDB All DBs Position I:complement(2893635..2893874) Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEAEIKNEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYARANVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaacatcgaacaacgcgtgaagaagatcgtcgccgaacaactgggcgtcgccgaa gccgaaatcaagaacgaagcgtcgttcgtgaacgacctcggcgcggactcgctcgacacg gtcgagctggtgatggcgctcgaagacgagttcggcatggaaatcccggatgaagaggcc gagaagatcacgaccgttcagcaagcgatcgactacgctcgcgcgaacgtcaaggcgtaa

DBGET integrated database retrieval system