Burkholderia pseudomallei MSHR346: GBP346_A3840 Help Entry GBP346_A3840      CDS       T00894                                  Name (GenBank) conserved domain protein   KO K03116   sec-independent protein translocase protein TatA Organism bpr  Burkholderia pseudomallei MSHR346 Pathway bpr03060   Protein export bpr03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:bpr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     GBP346_A3840  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     GBP346_A3840  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:bpr02044]     GBP346_A3840 Secretion system [BR:bpr02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    GBP346_A3840 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Ni_hydr_CYTB Motif Other DBs NCBI-ProteinID:  ACQ97358 LinkDB All DBs Position I:complement(3695714..3695947) Genome browser AA seq 77 aa AA seqDB search MGGLSIWHWLIVLLIVALVFGTKKLRNIGNDLGSAVKGFKDGMKESEAPADAQQLPRSGS VNVDAKDAARSSDSNKA NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgggcggattgagtatttggcactggctgatcgtgttgctgatcgtcgcgctggtgttc ggcacgaagaagctgcgcaatatcggcaacgatctcggcagtgcggtcaagggcttcaag gacggcatgaaggagagcgaagcgcccgccgacgcgcagcaactgccgcgttcgggctcg gtgaacgtcgacgcgaaggatgcggcgcgttcgtcggattcgaacaaggcgtga

DBGET integrated database retrieval system