Butyrate-producing bacterium SS3/4: CK3_27500 Help Entry CK3_27500         CDS       T02611                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bprs  Butyrate-producing bacterium SS3/4 Pathway bprs01100   Metabolic pathways bprs01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bprs00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CK3_27500    00074 Mycolic acid biosynthesis     CK3_27500   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CK3_27500 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 TerB Motif Other DBs NCBI-ProteinID:  CBL42266 UniProt:  D7GWS4 LinkDB All DBs Position 2771559..2771789 Genome browser AA seq 76 aa AA seqDB search MEFEKLQQIIAEVLNIDPEEITMNTTFVDDLGADSLDVFQIIMGIEEEFDIEIPTEEAEK IASVGDAVEAIKNALN NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggagtttgaaaaattacagcagatcatcgcagaggttctcaatatcgatccggaggag atcacaatgaacactacattcgttgatgatctcggcgcagattccctggatgtattccag atcattatgggtatcgaggaagagttcgacattgagatcccgactgaggaagctgagaag atcgcaagtgtcggcgatgctgttgaggcaatcaaaaacgcattaaattaa

DBGET integrated database retrieval system