Burkholderia pseudomallei K96243: BPSL2439 Help Entry BPSL2439          CDS       T00203                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bps  Burkholderia pseudomallei K96243 Pathway bps00998   Biosynthesis of various antibiotics bps01100   Metabolic pathways bps01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bps00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BPSL2439 (acpP)    00074 Mycolic acid biosynthesis     BPSL2439 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BPSL2439 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF1896 DUF1493 Motif Other DBs NCBI-ProteinID:  CAH36442 UniProt:  Q63S86 LinkDB All DBs Position 1:complement(2944967..2945206) Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEAEIKNEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYARANVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaacatcgaacaacgcgtgaagaagatcgtcgccgaacaactgggcgtcgccgaa gccgaaatcaagaacgaagcgtcgttcgtgaacgacctcggcgcggactcgctcgacacg gtcgagctggtgatggcgctcgaagacgagttcggcatggaaatcccggatgaagaagcc gagaagatcacgaccgttcagcaagcgatcgactacgctcgcgcgaacgtcaaggcgtaa

DBGET integrated database retrieval system