Burkholderia pseudomallei K96243: BPSS2131 Help Entry BPSS2131          CDS       T00203                                  Name (GenBank) conserved hypothetical protein   KO K03746   DNA-binding protein H-NS Organism bps  Burkholderia pseudomallei K96243 Brite KEGG Orthology (KO) [BR:bps00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bps03036]     BPSS2131    03400 DNA repair and recombination proteins [BR:bps03400]     BPSS2131 Chromosome and associated proteins [BR:bps03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     BPSS2131 DNA repair and recombination proteins [BR:bps03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       BPSS2131 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS FIMAH Frankia_peptide HalX Motif Other DBs NCBI-ProteinID:  CAH39612 UniProt:  Q63IE2 LinkDB All DBs Position 2:complement(2885962..2886252) Genome browser AA seq 96 aa AA seqDB search MATYRQLTAQLEKLQQKIDKEREKAITDAIADIKAKIEEYDITPEELGFRSVKAAAKPKR ALPPKYLNPKTGETWSGRGRAPAWLGKNRNRFLIKD NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atggcgacctataggcaactgaccgcacagctcgaaaaacttcagcagaaaatcgacaag gaacgcgaaaaggcgatcacggacgcgattgccgatatcaaggcgaagatcgaggaatac gacatcacgccggaagagttggggttcagaagcgtcaaggcggcggcgaagccgaagcgc gcgctgccgccgaagtacctcaatccgaagacgggcgagacctggagcggccgcggccgc gcgccggcgtggctcggcaagaatcgcaaccgtttcctgatcaaggactga

DBGET integrated database retrieval system