Burkholderia pseudomallei NAU35A-3: BBU_1621 Help Entry BBU_1621          CDS       T03476                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism bpsa  Burkholderia pseudomallei NAU35A-3 Pathway bpsa00190   Oxidative phosphorylation bpsa01100   Metabolic pathways bpsa02020   Two-component system Module bpsa_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:bpsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     BBU_1621  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     BBU_1621 Enzymes [BR:bpsa01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      BBU_1621 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  AIS88879 LinkDB All DBs Position 1:1960452..1960550 Genome browser AA seq 32 aa AA seqDB search MWYFSWILGIGVALAFGIINAMWLEARQKRDA NT seq 99 nt NT seq  +upstreamnt  +downstreamnt atgtggtacttcagctggattctcggcatcggcgtcgcgctcgcgttcggcatcatcaat gcgatgtggctcgaagcgcggcaaaagcgcgacgcgtag

DBGET integrated database retrieval system