Burkholderia pseudomallei NAU35A-3: BBU_3119 Help Entry BBU_3119          CDS       T03476                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bpsa  Burkholderia pseudomallei NAU35A-3 Pathway bpsa00998   Biosynthesis of various antibiotics bpsa01100   Metabolic pathways bpsa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bpsa00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BBU_3119 (acpP)    00074 Mycolic acid biosynthesis     BBU_3119 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BBU_3119 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L50 DUF1896 DUF1493 Motif Other DBs NCBI-ProteinID:  AIS86770 LinkDB All DBs Position 1:3601356..3601595 Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEAEIKNEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYARANVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaacatcgaacaacgcgtgaagaagatcgtcgccgaacaactgggcgtcgccgaa gccgaaatcaagaacgaagcgtcgttcgtgaacgacctcggcgcggactcgctcgacacg gtcgagctggtgatggcgctcgaagacgagttcggcatggaaatcccggatgaagaggcc gagaagatcacgaccgttcagcaagcgatcgactacgctcgcgcgaacgtcaaggcgtaa

DBGET integrated database retrieval system