Burkholderia pseudomallei NAU35A-3: BBU_5183 Help Entry BBU_5183          CDS       T03476                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism bpsa  Burkholderia pseudomallei NAU35A-3 Brite KEGG Orthology (KO) [BR:bpsa00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bpsa03036]     BBU_5183    03400 DNA repair and recombination proteins [BR:bpsa03400]     BBU_5183 Chromosome and associated proteins [BR:bpsa03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     BBU_5183 DNA repair and recombination proteins [BR:bpsa03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       BBU_5183 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Motif Other DBs NCBI-ProteinID:  AIS90741 LinkDB All DBs Position 2:complement(2282726..2282986) Genome browser AA seq 86 aa AA seqDB search MDDLKQQAKRARALELPDVLVGLRKKIVEYGLSQKDLFPPRLGRPKKADALPKPRYRDPD TGATWTGRGRAPAWIAGQDRERFRID NT seq 261 nt NT seq  +upstreamnt  +downstreamnt ttggatgatttgaagcagcaggcgaagcgcgcccgcgcgctcgagttgcccgacgtgctc gtcgggctgcgcaagaagatcgtcgaatacggtctctcgcagaaagacctgtttccgcct cgcctcggacggccgaagaaagccgacgcgctgccgaagccgcgctatcgcgatccggac acgggcgcgacatggacggggcgcggccgcgcgcccgcctggatcgcggggcaggaccgc gagcggttccggatcgattag

DBGET integrated database retrieval system