KEGG   Burkholderia pseudomallei NAU35A-3: BBU_725
Entry
BBU_725           CDS       T03476                                 
Name
(GenBank) NAD(P)H binding domain of trans-2-enoyl-CoA reductase family protein
  KO
K00209  enoyl-[acyl-carrier protein] reductase / trans-2-enoyl-CoA reductase (NAD+) [EC:1.3.1.9 1.3.1.44]
Organism
bpsa  Burkholderia pseudomallei NAU35A-3
Pathway
bpsa00061  Fatty acid biosynthesis
bpsa00650  Butanoate metabolism
bpsa01100  Metabolic pathways
bpsa01110  Biosynthesis of secondary metabolites
bpsa01120  Microbial metabolism in diverse environments
bpsa01200  Carbon metabolism
bpsa01212  Fatty acid metabolism
Module
bpsa_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bpsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BBU_725
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BBU_725
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bpsa01004]
    BBU_725
Enzymes [BR:bpsa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     BBU_725
    1.3.1.44  trans-2-enoyl-CoA reductase (NAD+)
     BBU_725
Lipid biosynthesis proteins [BR:bpsa01004]
 Fatty acid synthase
  Component type
   BBU_725
SSDB
Motif
Pfam: Enoyl_reductase Eno-Rase_NADH_b Eno-Rase_FAD_bd
Other DBs
NCBI-ProteinID: AIS88209
LinkDB
Position
1:883072..884265
AA seq 397 aa
MIIKPRVRGFICVTTHPAGCAASVREQIAYVARRGPIERGPKKVLVIGASTGYGLAARIA
AAFGAGAATLGVFFERAPADAKPGTAGWYNSAAFHDEAAARGLQATSINGDAFSDEIKHK
TIDAIRRDLGQVDLVVYSVAAPRRTHPKTGVTHQSTLKPIGHAVRLRGIDTDNEAIKETL
LQPATPDEIADTVAVMGGEDWRMWIDALDAAGVLADGAKTTAFTYLGEQVTHDIYWNGSI
GEAKKDLDRTVLALRGKLAARGGDARVSVLKAVVTQASSAIPMMPLYLSLLFKVMKARGT
HEGCIEQVDGLLRDSLYGAQPHVDAEGRLRADRLELDPAVQARVLELWDQVTDDNLYTLT
DFAGYKAEFLRLFGFGIDGVDYDAPVEPNVRIPNLIE
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgatcatcaaaccgcgcgtacgcggcttcatctgcgtcaccacccaccccgccggctgc
gcggcgagcgttcgcgagcagatcgcgtacgtcgcccgccgcggcccgatcgagcgcggc
ccgaagaaggtgctcgtgatcggcgcgtcgacgggctacgggctcgccgcgcgcatcgcc
gccgcgttcggcgcgggcgcggcgacgctcggggtgttcttcgagcgcgcgccggcggac
gcgaagcccggcacggccggctggtacaacagcgcggcgttccacgacgaagcggccgcg
cgcggcctccaggcgacgagcatcaacggcgacgcgttctccgacgagatcaagcacaag
acgatcgatgcgatccggcgcgatctcgggcaggtggaccttgtcgtctacagcgtcgcc
gcgccgcgcaggacgcatccgaaaacgggcgtcacgcatcagtcgacgttgaagccgatc
ggccacgcggtgcggctgcgcggcatcgatacggacaacgaggcgatcaaggaaacgctg
ctgcagccggccacgcccgacgagatcgcggacacggtcgccgtgatgggcggcgaggac
tggcgcatgtggatcgacgcgctcgatgcggcgggagtgcttgccgacggcgcgaagacg
accgcgttcacgtatctgggcgagcaggtcacgcacgacatctactggaacggctcgatc
ggcgaagcgaagaaggatctcgaccgcaccgtgctcgcgctgcgcggcaagctcgccgcg
cgcggcggcgacgcgcgcgtctcggtgctgaaggcggtcgtcacgcaggcgagctccgcg
atcccgatgatgccgctctacctgtcgctgctcttcaaggtgatgaaggcgcgcggcacg
catgaaggctgcatcgagcaggtcgacggcctgttgcgcgacagcctgtacggcgcgcag
ccgcacgtcgacgccgaaggccggctgcgcgcggaccgcctcgagctcgatccggccgtg
caggcgcgcgtgctcgagctgtgggaccaggtgacggacgacaatctgtatacgctcacc
gatttcgccggctacaaggccgaattcctgcgcctgttcggcttcgggatcgacggcgtc
gattacgatgcgcctgtcgagccgaacgtacggattccgaatctgatcgaatga

DBGET integrated database retrieval system