Burkholderia pseudomallei MSHR520: BBX_1403 Help Entry BBX_1403          CDS       T03163                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bpsd  Burkholderia pseudomallei MSHR520 Pathway bpsd00998   Biosynthesis of various antibiotics bpsd01100   Metabolic pathways bpsd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bpsd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BBX_1403 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BBX_1403 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 DUF1896 DUF1493 Motif Other DBs NCBI-ProteinID:  AHK64124 LinkDB All DBs Position 1:1522336..1522575 Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEAEIKNEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYARANVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaacatcgaacaacgcgtgaagaagatcgtcgccgaacaactgggcgtcgccgaa gccgaaatcaagaacgaagcgtcgttcgtgaacgacctcggcgcggactcgctcgacacg gtcgagctggtgatggcgctcgaagacgagttcggcatggaaatcccggatgaagaggcc gagaagatcacgaccgttcagcaagcgatcgactacgctcgcgcgaacgtcaaggcgtaa

DBGET integrated database retrieval system