Burkholderia pseudomallei MSHR520: BBX_4001 Help Entry BBX_4001          CDS       T03163                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism bpsd  Burkholderia pseudomallei MSHR520 Brite KEGG Orthology (KO) [BR:bpsd00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bpsd03036]     BBX_4001    03400 DNA repair and recombination proteins [BR:bpsd03400]     BBX_4001 Chromosome and associated proteins [BR:bpsd03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     BBX_4001 DNA repair and recombination proteins [BR:bpsd03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       BBX_4001 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS HalX Motif Other DBs NCBI-ProteinID:  AHK69774 LinkDB All DBs Position 2:complement(594418..594720) Genome browser AA seq 100 aa AA seqDB search MVERMATYKELKARAEALSAQAEAARQAELQAAIEDVRAKVREYGLTAYDVFGHRKKPGE RHRGAVRPKYRDPATGATWTGRGIEPKWIRGRNRDEFLIE NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atggttgaacgcatggcgacatacaaggaactgaaggctcgggccgaggcgttgagcgcg caggccgaagcggcgcggcaggctgaattgcaggccgcgatcgaagacgtgcgcgcgaag gtgcgcgagtacggtctcacggcgtacgacgtgttcggacaccgaaagaaaccgggcgag cgccatcgcggggcggtcaggccgaagtaccgcgatccggcgacgggcgcgacctggacc ggacgcggcatcgagccgaaatggatccggggccgcaatcgggacgaattcctgatcgaa tga

DBGET integrated database retrieval system