Burkholderia pseudomallei MSHR520: BBX_5974 Help Entry BBX_5974          CDS       T03163                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism bpsd  Burkholderia pseudomallei MSHR520 Brite KEGG Orthology (KO) [BR:bpsd00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bpsd03036]     BBX_5974    03400 DNA repair and recombination proteins [BR:bpsd03400]     BBX_5974 Chromosome and associated proteins [BR:bpsd03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     BBX_5974 DNA repair and recombination proteins [BR:bpsd03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       BBX_5974 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Motif Other DBs NCBI-ProteinID:  AHK67351 LinkDB All DBs Position 2:3044821..3045081 Genome browser AA seq 86 aa AA seqDB search MDDLKQQAKRARALELPDVLVGLRKKIVEYGLSQKDLFPPRLGRPKKADALPKPRYRDPD TGATWTGRGRAPAWIAGQDRERFRID NT seq 261 nt NT seq  +upstreamnt  +downstreamnt ttggatgatttgaagcagcaggcgaagcgcgcccgcgcgctcgagttgcccgacgtgctc gtcgggttgcgcaagaagatcgtcgaatacggtctctcgcagaaagacctgtttccgcct cgcctcggacggccgaagaaagccgacgcgctgccgaagccgcgctatcgcgatccggac acgggcgcgacatggacggggcgcggccgcgcgcccgcctggatcgcggggcaggaccgc gagcggttccggatcgattag

DBGET integrated database retrieval system