Burkholderia pseudomallei MSHR305: BDL_4134 Help Entry BDL_4134          CDS       T02756                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism bpse  Burkholderia pseudomallei MSHR305 Brite KEGG Orthology (KO) [BR:bpse00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bpse03036]     BDL_4134    03400 DNA repair and recombination proteins [BR:bpse03400]     BDL_4134 Chromosome and associated proteins [BR:bpse03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     BDL_4134 DNA repair and recombination proteins [BR:bpse03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       BDL_4134 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Motif Other DBs NCBI-ProteinID:  AGR68853 LinkDB All DBs Position 1:755789..756049 Genome browser AA seq 86 aa AA seqDB search MDDLKQQAKRARALELPDVLVGLRKKIVEYGLSQKDLFPPRLGRPKKADALPKPRYRDPD TGATWTGRGRAPAWIAGQDRERFRID NT seq 261 nt NT seq  +upstreamnt  +downstreamnt ttggatgatttgaagcagcaggcgaagcgcgcccgcgcgctcgagttgcccgacgtgctc gtcgggttgcgcaagaagatcgtcgaatacggtctctcgcagaaagacctgtttccgcct cgcctcggacggccgaagaaagccgacgcgctgccgaagccgcgctatcgcgatccggac acgggcgcgacatggacggggcgcggccgcgcgcccgcctggatcgcggggcaggaccgc gagcggttccggatcgattag

DBGET integrated database retrieval system