Basilea psittacipulmonis: IX83_08085 Help Entry IX83_08085        CDS       T03226                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bpsi  Basilea psittacipulmonis Pathway bpsi01100   Metabolic pathways bpsi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bpsi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     IX83_08085    00074 Mycolic acid biosynthesis     IX83_08085   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     IX83_08085 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AIL33260 UniProt:  A0A077DEK2 LinkDB All DBs Position 1824709..1824972 Genome browser AA seq 87 aa AA seqDB search MNSDLALSIKQLIIDTLSLEDMTPEDIDTDAPLFGDGLGLDSVDALELGLAIQKKYGITM DSESQNIKENFYSVATLANYIASQNKE NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgaattcagatttagcattatccattaaacagctaattattgacacgctttcattagaa gatatgacccccgaagatatcgacactgatgcaccattatttggcgatggacttggttta gattcggtcgatgctctagaattaggtttggccatacagaaaaaatatggcatcaccatg gatagtgaatctcaaaacatcaaagaaaacttttacagcgttgctaccttagctaactat atcgcttcacaaaacaaggaataa

DBGET integrated database retrieval system