Burkholderia pseudomultivorans: WS57_32550 Help Entry WS57_32550        CDS       T04870                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bpsl  Burkholderia pseudomultivorans Pathway bpsl00998   Biosynthesis of various antibiotics bpsl01100   Metabolic pathways bpsl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bpsl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     WS57_32550    00074 Mycolic acid biosynthesis     WS57_32550   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     WS57_32550 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AOI94049 UniProt:  A0A132EEJ1 LinkDB All DBs Position 1:complement(4396051..4396311) Genome browser AA seq 86 aa AA seqDB search MNALEQELATLIVGELNLEDVPLETVTADTPLYGEGFGLDSIDILEIALLISKKYGFELR SDNPDNQKIFATLGALAAYVAAHRTK NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgaacgcactggaacaagagctcgccacgctgatcgtcggcgaactgaacctcgaagac gtcccgctcgaaacagtgacggccgacaccccgctgtatggcgagggcttcgggctcgac tccatcgacatcctggaaatcgcgctgctgatctcgaagaagtacggcttcgagctgcgc tcggacaatcccgacaaccagaagatcttcgcgacgctcggcgcgctggcggcgtacgtc gccgcgcatcgcacgaagtga

DBGET integrated database retrieval system