Burkholderia pseudomallei MSHR511: BBQ_5290 Help Entry BBQ_5290          CDS       T03012                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism bpsm  Burkholderia pseudomallei MSHR511 Brite KEGG Orthology (KO) [BR:bpsm00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bpsm03036]     BBQ_5290    03400 DNA repair and recombination proteins [BR:bpsm03400]     BBQ_5290 Chromosome and associated proteins [BR:bpsm03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     BBQ_5290 DNA repair and recombination proteins [BR:bpsm03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       BBQ_5290 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Motif Other DBs NCBI-ProteinID:  AHG36277 LinkDB All DBs Position 2:complement(2257325..2257585) Genome browser AA seq 86 aa AA seqDB search MDDLKQQAKRARALELPDVLVGLRKKIVEYGLSQKDLFPPRLGRPKKADALPKPRYRDPD TGATWTGRGRAPAWIAGQDRERFRID NT seq 261 nt NT seq  +upstreamnt  +downstreamnt ttggatgatttgaagcagcaggcgaagcgcgcccgcgcgctcgagttgcccgacgtgctc gtcgggctgcgcaagaagatcgtcgaatacggtctctcgcagaaagacctgtttccgcct cgcctcggacggccgaagaaagccgacgcgctgccgaagccgcgctatcgcgatccggac acgggcgcgacatggacggggcgcggccgcgcgcccgcctggatcgcggggcaggaccgc gagcggttccggatcgattag

DBGET integrated database retrieval system