Burkholderia pseudomallei MSHR511: BBQ_868 Help Entry BBQ_868           CDS       T03012                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bpsm  Burkholderia pseudomallei MSHR511 Pathway bpsm00998   Biosynthesis of various antibiotics bpsm01100   Metabolic pathways bpsm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bpsm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BBQ_868 (acpP)    00074 Mycolic acid biosynthesis     BBQ_868 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BBQ_868 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF1896 DUF1493 Motif Other DBs NCBI-ProteinID:  AHG33601 LinkDB All DBs Position 1:935143..935382 Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEAEIKNEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYARANVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaacatcgaacaacgcgtgaagaagatcgtcgccgaacaactgggcgtcgccgaa gccgaaatcaagaacgaagcgtcgttcgtgaacgacctcggcgcggactcgctcgacacg gtcgagctggtgatggcgctcgaagacgagttcggcatggaaatcccggatgaagaggcc gagaagatcacgaccgttcagcaagcgatcgactacgctcgcgcgaacgtcaaggcgtaa

DBGET integrated database retrieval system