Burkholderia pseudomallei A79A: X996_1722 Help Entry X996_1722         CDS       T03498                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bpso  Burkholderia pseudomallei A79A Pathway bpso00998   Biosynthesis of various antibiotics bpso01100   Metabolic pathways bpso01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bpso00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     X996_1722 (acpP)    00074 Mycolic acid biosynthesis     X996_1722 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     X996_1722 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L50 DUF1896 DUF1493 Motif Other DBs NCBI-ProteinID:  AIV96503 LinkDB All DBs Position 1:1916311..1916550 Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEAEIKNEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYARANVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaacatcgaacaacgcgtgaagaagatcgtcgccgaacaactgggcgtcgccgaa gccgaaatcaagaacgaagcgtcgttcgtgaacgacctcggcgcggactcgctcgacacg gtcgagctggtgatggcgctcgaagacgagttcggcatggaaatcccggatgaagaggcc gagaagatcacgaccgttcagcaagcgatcgactacgctcgcgcgaacgtcaaggcgtaa

DBGET integrated database retrieval system