Burkholderia pseudomallei A79A: X996_2760 Help Entry X996_2760         CDS       T03498                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism bpso  Burkholderia pseudomallei A79A Brite KEGG Orthology (KO) [BR:bpso00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bpso03036]     X996_2760    03400 DNA repair and recombination proteins [BR:bpso03400]     X996_2760 Chromosome and associated proteins [BR:bpso03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     X996_2760 DNA repair and recombination proteins [BR:bpso03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       X996_2760 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Motif Other DBs NCBI-ProteinID:  AIV95434 LinkDB All DBs Position 1:3162633..3162914 Genome browser AA seq 93 aa AA seqDB search METYLDLLAEREALMIKLDAARMQARSAALSEVKRIVEEFELTTQEVFGRAGVLRRRGKL KPKYRDPKTGATWNGRGRPPSWIAGKDRAAFVA NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggaaacctacctcgaccttctggccgaacgagaagccctgatgatcaagctggatgcg gcgcgcatgcaggcgcgcagcgccgcgctatccgaagtgaagcgaatcgtcgaggaattc gaactcacgacgcaggaagtgttcggccgcgcgggcgtgctgcgccgtcgcggcaagctc aagccgaagtatcgcgatccgaaaaccggcgcgacctggaacggccgcggccgcccgcct tcgtggatcgccggaaaggatcgcgccgcgttcgtcgcttga

DBGET integrated database retrieval system