Burkholderia pseudomallei MSHR146: BBN_139 Help Entry BBN_139           CDS       T03024                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism bpsu  Burkholderia pseudomallei MSHR146 Brite KEGG Orthology (KO) [BR:bpsu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bpsu03036]     BBN_139    03400 DNA repair and recombination proteins [BR:bpsu03400]     BBN_139 Chromosome and associated proteins [BR:bpsu03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     BBN_139 DNA repair and recombination proteins [BR:bpsu03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       BBN_139 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Topoisom_I_N Motif Other DBs NCBI-ProteinID:  AHG66678 LinkDB All DBs Position 1:160100..160393 Genome browser AA seq 97 aa AA seqDB search MSSYKDLLAQREKLEKQIEEAKSREYAEVLSDVKQKIADYGFTLAELGLGRGKAGKAGRP RAGVAAKYRDPESGATWSGRGKPPRWIAGKNREQFAI NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgtcttcttacaaggaccttctcgctcagcgagagaagctggagaagcagatcgaagaa gccaagtcgcgcgaatacgcggaggtattgagcgacgtcaagcaaaagatcgccgattac ggtttcacgctcgcggaactcggtctcggtcgtggcaaagctggaaaagcggggcgaccc cgcgctggcgtcgcggcgaaataccgcgatccggaatccggcgcaacctggtcgggccgc gggaagcctcctcgctggatcgccggcaagaatcgcgaacaattcgcgatctga

DBGET integrated database retrieval system