Burkholderia pseudomallei MSHR146: BBN_3029 Help Entry BBN_3029          CDS       T03024                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism bpsu  Burkholderia pseudomallei MSHR146 Pathway bpsu00190   Oxidative phosphorylation bpsu01100   Metabolic pathways bpsu02020   Two-component system Module bpsu_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:bpsu00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     BBN_3029  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     BBN_3029 Enzymes [BR:bpsu01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      BBN_3029 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  AHG68722 LinkDB All DBs Position 1:3513773..3513871 Genome browser AA seq 32 aa AA seqDB search MWYFSWILGIGVALAFGIINAMWLEARQKRDA NT seq 99 nt NT seq  +upstreamnt  +downstreamnt atgtggtacttcagctggattctcggcatcggcgtcgcgctcgcgttcggcatcatcaat gcgatgtggctcgaagcgcggcaaaagcgcgacgcgtag

DBGET integrated database retrieval system