Burkholderia pseudomallei MSHR146: BBN_995 Help Entry BBN_995           CDS       T03024                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bpsu  Burkholderia pseudomallei MSHR146 Pathway bpsu00998   Biosynthesis of various antibiotics bpsu01100   Metabolic pathways bpsu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bpsu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BBN_995 (acpP)    00074 Mycolic acid biosynthesis     BBN_995 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BBN_995 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF1896 DUF1493 Motif Other DBs NCBI-ProteinID:  AHG69137 LinkDB All DBs Position 1:1080885..1081124 Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEAEIKNEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYARANVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaacatcgaacaacgcgtgaagaagatcgtcgccgaacaactgggcgtcgccgaa gccgaaatcaagaacgaagcgtcgttcgtgaacgacctcggcgcggactcgctcgacacg gtcgagctggtgatggcgctcgaagacgagttcggcatggaaatcccggatgaagaggcc gagaagatcacgaccgttcagcaagcgatcgactacgctcgcgcgaacgtcaaggcgtaa

DBGET integrated database retrieval system