Bordetella petrii: Bpet1036 Help Entry Bpet1036          CDS       T00637                                  Symbol ssb1 Name (GenBank) ssb1   KO K03111   single-strand DNA-binding protein Organism bpt  Bordetella petrii Pathway bpt03030   DNA replication bpt03430   Mismatch repair bpt03440   Homologous recombination Brite KEGG Orthology (KO) [BR:bpt00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     Bpet1036 (ssb1)    03430 Mismatch repair     Bpet1036 (ssb1)    03440 Homologous recombination     Bpet1036 (ssb1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:bpt03032]     Bpet1036 (ssb1)    03400 DNA repair and recombination proteins [BR:bpt03400]     Bpet1036 (ssb1)    03029 Mitochondrial biogenesis [BR:bpt03029]     Bpet1036 (ssb1) DNA replication proteins [BR:bpt03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     Bpet1036 (ssb1) DNA repair and recombination proteins [BR:bpt03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     Other MMR factors      Bpet1036 (ssb1)   TLS (translesion DNA synthesis) factors    Other SOS response factors     Bpet1036 (ssb1) Mitochondrial biogenesis [BR:bpt03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA replication factors    Other Mitochondrial DNA replication factors     Bpet1036 (ssb1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SSB Motif Other DBs NCBI-ProteinID:  CAP41368 UniProt:  A9IB46 LinkDB All DBs Position 1103826..1104278 Genome browser AA seq 150 aa AA seqDB search MSTHFSGEGNIGSPPEYREFPNGNDEPRRLLRLNVYFDNPVPTKGGDYEDRGGFWAPVEI WHRDAAHWKDLYQKGMRVLVVGRMEREPWTDNEDQPRETWQINARSVGILPFRIESVVLS PKSQETAQDAQPKPQAAQEPAAPKEPKRRK NT seq 453 nt NT seq  +upstreamnt  +downstreamnt atgagcacgcatttttcgggcgaaggcaacatcggctcgccccccgagtaccgggagttc cccaacggcaacgacgaaccgcggcgcttgttgcggctgaacgtgtatttcgacaacccc gttcccaccaagggcggcgactatgaggatcgcggcggcttctgggcgccggtggaaatc tggcaccgcgacgccgcgcactggaaggacctctaccagaagggcatgcgcgtgctggtc gtcggccgcatggagcgcgaaccctggaccgacaacgaggatcagccacgtgagacttgg cagatcaacgcgcgcagcgtcggcatcctgccgttccgcatcgagtccgtcgtcctgagc cccaaatcgcaggagaccgcacaggacgcgcagcccaagccccaggccgcccaggaaccg gctgcgccgaaggagcccaagcgcaggaagtga

DBGET integrated database retrieval system