KEGG   Bordetella petrii: Bpet1331
Entry
Bpet1331          CDS       T00637                                 
Name
(GenBank) 2,4-dichlorophenol 6-monooxygenase
  KO
K10676  2,4-dichlorophenol 6-monooxygenase [EC:1.14.13.20]
Organism
bpt  Bordetella petrii
Pathway
bpt00361  Chlorocyclohexane and chlorobenzene degradation
bpt01100  Metabolic pathways
bpt01120  Microbial metabolism in diverse environments
bpt01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bpt00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00361 Chlorocyclohexane and chlorobenzene degradation
    Bpet1331
Enzymes [BR:bpt01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.20  2,4-dichlorophenol 6-monooxygenase
     Bpet1331
SSDB
Motif
Pfam: FAD_binding_3 Pyr_redox_2 DAO FAD_binding_2 Thi4 FAD_oxidored Pyr_redox_3 GIDA Pyr_redox NAD_binding_8 HI0933_like
Other DBs
NCBI-ProteinID: CAP41666
UniProt: A9IE21
LinkDB
Position
1393394..1395133
AA seq 579 aa
MLETDVVIIGSGPAGSSAALMLSSYGIKNVVITKYRWLADSPRAHYVSQRTMEIVRDLGI
ESEVIAKASPKEVMGDVVFCTSLTGDEIGRLPYGMNGPRRATEYLEASPSEQCDLPQHLF
EPILLSNAAARGSHARFDTEYLSHRQDPEGVTVEVRDRLTGTTYEIRCKYLIGADGAGSK
VVRDLNLPMAGQMGKSGSMSIIFDADLSKYIAHRPGYLWWIVQPGANIGGIGLGLLRMVR
PWNEWQIVWGYDIDQPAPELTIDEAIAVCRQLIGDPDIEISIRSKSLWTVNEMYATQYAK
GRVFCMGDAVHRHPPSNGLGSNTSIQDAYNLCWKLAFVLRGQAAPALLDTYNQERAPVGE
RIVKRANQSVRDFGPVFEALGLDGRYNAKDMQTRIDSLKDTDQAGADRRARLRDAIEFKS
YEFAALGVETNVRYQSTAIAPTQPLQPSSDRDEDLHYFPSCVPGHKLPHGWMVRKGNKLS
TLDLIGGGRFTLLCWLQGQPWADAARKLSEDANVVLEVIQIGTGQDVQDAYGDLARVWNR
GEQACLLVRPDGYVAWEGLDMTAAYDALRQGVMAVLGRT
NT seq 1740 nt   +upstreamnt  +downstreamnt
atgttggaaaccgatgttgtgatcatcggcagcggccctgcgggatcgtcggctgccttg
atgctcagttcctatggaataaagaatgttgtcatcacgaaatacaggtggttggcggat
tcaccgcgcgcccattatgtcagccagcggacgatggagatcgtccgggacctcggcata
gagagcgaggtcatcgccaaggcttccccgaaagaagtcatgggagacgtggtgttctgc
acgtccttgacaggcgatgagatcggccgattgccctatggtatgaacggccctcggcgc
gcaaccgagtatctggaggcaagccccagcgaacagtgcgatttgccgcaacatctcttc
gagccgatcttgctttccaatgcggctgcccgcggctcccatgcgcggttcgacaccgag
tatctgtcacataggcaggacccggaaggcgtgaccgtcgaggtgcgggatcgcctgacc
ggaacgacttacgagatccgttgcaaatatctcatcggtgcagacggcgccggcagcaaa
gtcgttcgcgatctgaatttgccaatggccgggcaaatgggaaaaagcgggagcatgagc
atcatcttcgatgccgatctcagcaagtacatcgcccacaggcccggctatctttggtgg
atcgttcagccaggcgccaacatcggcggcataggcctggggctactgcgaatggtcagg
ccctggaacgaatggcaaatcgtgtggggttacgatattgaccaacccgctccggaactg
acgatcgacgaagccattgccgtctgccgccagctgattggcgaccctgacatcgagatc
agcatacgcagcaaatccttgtggaccgtcaatgaaatgtacgccacgcagtacgcgaaa
ggccgcgtattctgcatgggcgacgctgtgcatcggcacccgccgtccaacggactgggg
tcgaatacgtcgatccaggacgcctacaacttgtgctggaagcttgcgttcgtgttgcgg
ggacaagcagcgccggcgctgctggacacctacaatcaggagcgtgccccggtaggcgaa
cggatcgtgaaacgggccaatcagagcgttcgcgactttggcccggtattcgaggcgctt
ggcctggatgggcggtacaatgcgaaagacatgcagacccgcatcgattcgttgaaggat
accgatcaggcgggggccgacaggcgcgccaggctgcgggacgccatcgaattcaaatcc
tatgaattcgccgcactgggcgttgaaacaaatgttcgctatcagtcgacggcaatcgca
ccgacacaaccgctgcagccatcatcagaccgggacgaagatctacactatttcccctcc
tgcgtgccgggccacaagctgccgcacggctggatggtccgtaagggcaacaagctctcc
acgctggatctgataggaggcgggcgcttcacactgttgtgctggctccagggtcagcca
tgggccgatgccgccagaaagctctccgaagacgccaatgtagtgctcgaggtcatccag
atcggaaccggccaggatgtgcaagatgcttacggggatctggcgcgcgtctggaaccgt
ggagaacaggcctgcttgctggttcggccggacggctatgtcgcatgggaggggctggat
atgaccgccgcgtacgatgccctgcgacagggggtgatggctgttctcggccgcacctga

DBGET integrated database retrieval system