KEGG   Bordetella petrii: Bpet1400
Entry
Bpet1400          CDS       T00637                                 
Symbol
catA2
Name
(GenBank) catechol 1,2-dioxygenase
  KO
K03381  catechol 1,2-dioxygenase [EC:1.13.11.1]
Organism
bpt  Bordetella petrii
Pathway
bpt00361  Chlorocyclohexane and chlorobenzene degradation
bpt00362  Benzoate degradation
bpt00364  Fluorobenzoate degradation
bpt00623  Toluene degradation
bpt01100  Metabolic pathways
bpt01120  Microbial metabolism in diverse environments
bpt01220  Degradation of aromatic compounds
Module
bpt_M00568  Catechol ortho-cleavage, catechol => 3-oxoadipate
Brite
KEGG Orthology (KO) [BR:bpt00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bpet1400 (catA2)
   00364 Fluorobenzoate degradation
    Bpet1400 (catA2)
   00361 Chlorocyclohexane and chlorobenzene degradation
    Bpet1400 (catA2)
   00623 Toluene degradation
    Bpet1400 (catA2)
Enzymes [BR:bpt01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.1  catechol 1,2-dioxygenase
     Bpet1400 (catA2)
SSDB
Motif
Pfam: Dioxygenase_C Dioxygenase_N CarboxypepD_reg DUF4198
Other DBs
NCBI-ProteinID: CAP41735
UniProt: A9IEE1
LinkDB
Position
complement(1459999..1460934)
AA seq 311 aa
MSVQIFNTPEVQDFLRLASGLDQSGGNPRVKQIVHRILSDLYKTIEDLKVTSDEYWAGIA
YLNRLGASGEAGLLSPGLGFDRYLDMRMDAEDAALGISDATPRTIEGPLYVAGAPVEHGY
ARLDDGSDKDGHTLIMHGTVRGADGKPLPGAQVEVWHANTKGFYSHYDPTGEQKPFNMRR
TIITDAQGRYKFQSIVPKGYGCPPDGPTQGLLNELGRHGNRPAHIHFFVTAEGHRKLTTQ
INIDGDPLVFDDFAYATREGLVPPLVEHADQASIQAEGLDGPFAEIVFDISLTALVNGVD
NQVVNRPRLAA
NT seq 936 nt   +upstreamnt  +downstreamnt
atgagcgtccaaattttcaatactcccgaggtgcaggacttcctgcgtttggccagtggc
ctggaccagagcggtggcaatccgcgcgtcaagcagatcgtccaccgcatcctgtccgat
ctgtacaagaccatcgaagatctgaaggtcacctctgacgagtactgggcgggcattgcg
tatctgaaccggctcggcgccagcggcgaagcaggcttgctctcgcccggcctgggcttc
gatcgttacctggacatgcgcatggatgccgaagatgccgccctcgggatctcggacgcc
acgccgcgcaccatcgagggccctctgtacgtggccggcgcgcctgtcgagcacggctat
gcgcggctggacgatggcagcgacaaggacggccacacgctgatcatgcacggcacggtc
cgcggcgcggatggcaagccgctgcccggcgcgcaggtcgaggtctggcacgccaatacc
aagggcttctactcccactatgaccccacgggcgagcaaaagccgttcaacatgcgccgc
accatcatcaccgacgcccagggacgttacaagttccagagcatcgtgcccaagggctat
ggctgtccgcctgacggtcccacgcaaggcctgctcaacgaactgggacggcatggcaac
cgccccgctcacatccacttcttcgtcaccgccgagggtcaccgcaagctgacgacgcag
atcaacatcgatggtgatccgctggtcttcgacgatttcgcctatgccacccgcgaaggg
ctcgtccctccgctggtcgagcacgccgaccaggccagcatccaggccgaagggctcgat
ggtcctttcgccgagatcgtcttcgacatctcgctgaccgccctggtcaacggcgttgac
aaccaggtcgtcaaccgcccccgccttgcggcctga

DBGET integrated database retrieval system