KEGG   Bordetella petrii: Bpet1534
Entry
Bpet1534          CDS       T00637                                 
Symbol
clcA
Name
(GenBank) catechol 1,2-dioxygenase
  KO
K15253  chlorocatechol 1,2-dioxygenase [EC:1.13.11.-]
Organism
bpt  Bordetella petrii
Pathway
bpt00361  Chlorocyclohexane and chlorobenzene degradation
bpt01100  Metabolic pathways
bpt01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpt00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00361 Chlorocyclohexane and chlorobenzene degradation
    Bpet1534 (clcA)
Enzymes [BR:bpt01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.-
     Bpet1534 (clcA)
SSDB
Motif
Pfam: Dioxygenase_C Dioxygenase_N CarboxypepD_reg
Other DBs
NCBI-ProteinID: CAP41873
UniProt: A9IG87
LinkDB
Position
1581886..1582668
AA seq 260 aa
MDKRVAEVAGAIVEAVRKILLDKRVTEAEYRAGVDYLTEVAQTRETALLLDVFLNSTIIE
GKAQRSRTSAPAVQGPYFLEGAPVVEGVLKTYDTDDHKPLIIRGTVRSDTGELLAGAVID
VWHSTPDGLYSGIHDNIPVDYYRGKLVTDSQGNYRVRTTMPVPYQIPYEGPTGRLLGHLG
SHTWRPAHVHFKVRKDGFEPLTTQYYFEGGKWVDDDCCHGVTPDLITPETIEDGVRVMTL
DFVIEREQAEQRKSATETVA
NT seq 783 nt   +upstreamnt  +downstreamnt
atggataaacgagttgccgaggtcgcaggcgcgatcgtcgaggcagtacgcaaaattttg
ctggacaagcgcgtcacggaagccgaataccgcgcgggtgtcgactatctcaccgaggtc
gcacagacgcgggaaaccgcgctgcttctggacgttttcctgaacagcaccatcatcgaa
ggcaaggcgcagcgctcgcggacctctgcgcctgcggtccaggggccgtacttcctggaa
ggtgctcctgtagttgaaggcgtcctcaagacctacgataccgacgaccacaaaccgctg
atcattcgcggtacggtgcgctcggacacgggcgagttgctcgctggcgctgtcatcgac
gtgtggcactcgacgcctgatggcttgtacagcgggatccacgacaacatccccgtggac
tactaccgcggaaaactcgtgacggattcccagggcaactatcgcgtgcgcaccacgatg
ccagtgccataccagatcccctacgaggggccgactgggcgtctgctgggccacctgggc
agccatacctggcgtccggcgcacgtgcacttcaaggtgcgcaaggacggtttcgaaccg
ttgaccacgcaatactacttcgaagggggcaaatgggtggacgatgactgctgtcacggc
gtcacccccgacctgattacgcccgagacgatcgaggacggggtgcgggtcatgaccctg
gacttcgtaatcgagcgtgagcaggccgagcaacgcaagtcggctacggagacagtggca
tga

DBGET integrated database retrieval system